PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Traes_5DS_4673CFE71.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Triticum
Family Dof
Protein Properties Length: 345aa    MW: 35681.6 Da    PI: 8.6945
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Traes_5DS_4673CFE71.1genomeIWGSCView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof120.65.7e-38112169562
                 zf-Dof   5 alkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 
                            +l+cprCds+ntkfCy+nnyslsqPr+fCkaCrryWt+GGalrnvPvGgg+r+n k+s
  Traes_5DS_4673CFE71.1 112 TLRCPRCDSANTKFCYFNNYSLSQPRHFCKACRRYWTRGGALRNVPVGGGCRRNTKRS 169
                            679***************************************************9886 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074782.0E-3195165IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.273113167IPR003851Zinc finger, Dof-type
PfamPF027011.6E-31113167IPR003851Zinc finger, Dof-type
PROSITE patternPS013610115151IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 345 aa     Download sequence    Send to blast
MVFSSFPIFL DPPSWTQMQQ QQPLQCFMGG GGGSEHQHHQ LIPASTGQLA PLPDVPGNTA  60
ASAPAVAGSS SASLQLVVSG QQGNPGEQPP RPSVSMTERA RMARVPLPEP GTLRCPRCDS  120
ANTKFCYFNN YSLSQPRHFC KACRRYWTRG GALRNVPVGG GCRRNTKRSS KKSSRQGQGQ  180
GGGGAVAAAT SSSSTTSTST TTSAAAATAA DVIASMQALP HHLGGLPAAA ALEASLEGYH  240
SHSHHQHHNL PFLPPQFLQQ GLHGYHFADG DIGSQLADGF PRGVASGLLA QLASIKMEEH  300
GAGAGGTGGG FVGAHEQYWP GSGGGGGWPT EFLSGFSSNS SGNVM
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAK3717790.0AK371779.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2141F19.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008668091.11e-110PREDICTED: uncharacterized protein LOC100273972 isoform X1
TrEMBLW5G2720.0W5G272_WHEAT; Uncharacterized protein
STRINGMLOC_74620.11e-176(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP14037367
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G02460.16e-38Dof family protein
Publications ? help Back to Top
  1. Brenchley R, et al.
    Analysis of the bread wheat genome using whole-genome shotgun sequencing.
    Nature, 2012. 491(7426): p. 705-10
    [PMID:23192148]